PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_1542_iso_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 160aa    MW: 17939 Da    PI: 9.9809
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_1542_iso_3genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.42.8e-0715511147
                                         HHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                      Myb_DNA-binding 11 llvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                         +++ + + +G+g+W+ I+r +   +t+ q+ s+ qky
  cra_locus_1542_iso_3_len_1081_ver_3 15 RFLLGLQAHGKGDWRNISRNFVRSKTPTQVASHAQKY 51
                                         7888999***************9*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.45E-91455IPR009057Homeodomain-like
CDDcd001671.39E-41452No hitNo description
TIGRFAMsTIGR015577.5E-111455IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.608.1E-51551IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
MIIDLDTAHV FDYRRFLLGL QAHGKGDWRN ISRNFVRSKT PTQVASHAQK YFLRQLSGGK  60
DKKRPSIHDI TTVHLPNTSP SDDNKSPNSS DKSAPSASSK LLLDWNNSND GLLMVFDSNH  120
GNESMESLFD IASRGHRYAA NICTTANSRF HIQPTKYVHG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002275014.12e-53PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H78e-38DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A068V2E55e-74A0A068V2E5_COFCA; Uncharacterized protein
STRINGVIT_13s0019g03370.t016e-53(Vitis vinifera)